ACTL7B monoclonal antibody (M01), clone 6A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ACTL7B monoclonal antibody (M01), clone 6A4 Western Blot analysis of ACTL7B expression in HeLa ( Cat # L013V1 ).
Western Blot detection against Immunogen (35.86 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACTL7B.
Immunogen
ACTL7B (NP_006677, 286 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACTL7B monoclonal antibody (M01), clone 6A4 Western Blot analysis of ACTL7B expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — ACTL7B
Entrez GeneID
10880GeneBank Accession#
NM_006686Protein Accession#
NP_006677Gene Name
ACTL7B
Gene Alias
-
Gene Description
actin-like 7B
Omim ID
604304Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known. [provided by RefSeq
Other Designations
OTTHUMP00000021867|actin-like 7-beta
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com