FAM12A monoclonal antibody (M01), clone 3D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (44 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant FAM12A.
Immunogen
FAM12A (NP_006674.2, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLRIIEPISN
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — FAM12A
Entrez GeneID
10876GeneBank Accession#
NM_006683.4Protein Accession#
NP_006674.2Gene Name
FAM12A
Gene Alias
EP3A, HE3-ALPHA, HE3A, HE3ALPHA, MGC119614, MGC119615
Gene Description
family with sequence similarity 12, member A
Omim ID
611580Gene Ontology
HyperlinkGene Summary
Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells. [provided by RefSeq
Other Designations
OTTHUMP00000164018|epididymal secretory protein E3 alpha|epididymis-specific 3 alpha|human epididymis-specific 3 alpha
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com