FGL2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FGL2 full-length ORF ( NP_006673.1, 1 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
76.6
Interspecies Antigen Sequence
Mouse (77); Rat (77)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FGL2
Entrez GeneID
10875GeneBank Accession#
NM_006682.2Protein Accession#
NP_006673.1Gene Name
FGL2
Gene Alias
T49, pT49
Gene Description
fibrinogen-like 2
Omim ID
605351Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq
Other Designations
fibrinogen-like protein 2|fibroleukin
-
Interactome
-
Disease
-
Publication Reference
-
Fc Receptor is Involved in Nk Cell Functional Anergy Induced by Miapaca2 Tumor Cell Line.
Yekaterina O Ostapchuk, Yuliya V Perfilyeva, Aikyn Kali, Raikhan Tleulieva, Oxana Yu Yurikova, Gulshan E Stanbekova, Boris V Karalnik, Nikolai N Belyaev.
Immunological Investigations 2020 Aug; 1.
Application:Func, Human, K-562, MiaPaCa2-TT cells.
-
Fc Receptor is Involved in Nk Cell Functional Anergy Induced by Miapaca2 Tumor Cell Line.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com