FGL2 monoclonal antibody (M02), clone 5A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGL2 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FGL2.
Immunogen
FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (77); Rat (77)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
FGL2 monoclonal antibody (M02), clone 5A10. Western Blot analysis of FGL2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGL2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — FGL2
Entrez GeneID
10875GeneBank Accession#
NM_006682Protein Accession#
NP_006673Gene Name
FGL2
Gene Alias
T49, pT49
Gene Description
fibrinogen-like 2
Omim ID
605351Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq
Other Designations
fibrinogen-like protein 2|fibroleukin
-
Interactome
-
Disease
-
Publication Reference
-
Fibrinogen-Like Protein 2/Fibroleukin Induces Long-Term Allograft Survival in a Rat Model through Regulatory B Cells.
Bézie S, Picarda E, Tesson L, Renaudin K, Durand J, Ménoret S, Mérieau E, Chiffoleau E, Guillonneau C, Caron L, Anegon I.
PLoS One 2015 Mar; 10(3):e119686.
Application：Flow Cyt, WB-Tr, Human, HEK293-pFGL2 cells.
-
Fibrinogen-Like Protein 2/Fibroleukin Induces Long-Term Allograft Survival in a Rat Model through Regulatory B Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com