FGL2 monoclonal antibody (M01), clone 6D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FGL2.
Immunogen
FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (77); Rat (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FGL2 monoclonal antibody (M01), clone 6D9. Western Blot analysis of FGL2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
FGL2 monoclonal antibody (M01), clone 6D9 Western Blot analysis of FGL2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
FGL2 monoclonal antibody (M01), clone 6D9. Western Blot analysis of FGL2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody (M01), clone 6D9.
Lane 1: FGL2 transfected lysate(50 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml]Immunoprecipitation
Immunoprecipitation of FGL2 transfected lysate using anti-FGL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGL2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGL2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — FGL2
Entrez GeneID
10875GeneBank Accession#
NM_006682Protein Accession#
NP_006673Gene Name
FGL2
Gene Alias
T49, pT49
Gene Description
fibrinogen-like 2
Omim ID
605351Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq
Other Designations
fibrinogen-like protein 2|fibroleukin
-
Interactome
-
Disease
-
Publication Reference
-
FGL2 promotes tumour growth and attenuates infiltration of activated immune cells in melanoma and ovarian cancer models.
Kristianne J C Galpin, Galaxia M Rodriguez, Vincent Maranda, David P Cook, Elizabeth Macdonald, Humaira Murshed, Shan Zhao, Curtis W McCloskey, Andrzej Chruscinski, Gary A Levy, Michele Ardolino, Barbara C Vanderhyden.
Scientific Reports 2024 Jan; 14(1):787.
Application:WB, Human, 786-O, A549, U-87 MG, MCF7, TOV3041G, OVCA420, OVCAR-8, THP-1, Jurkat, HTR8-WPI, HTR8-FGL2 cells.
-
Fibrinogen-like protein 2 regulates macrophage glycolytic reprogramming by directly targeting PKM2 and exacerbates alcoholic liver injury.
Xue Hu, Xiaoyang Wan, Yuting Diao, Zhe Shen, Zhongwei Zhang, Peng Wang, Danqin Hu, Xiaojing Wang, Weiming Yan, Chaohui Yu, Xiaoping Luo, Hongwu Wang, Qin Ning.
International Immunopharmacology 2023 Sep; 124(Pt B):110957.
Application:IF, IP, WB, Human, Mouse, BMDM, Human liver, Mouse liver, THP-1 cells.
-
Presence and activity of Fibrinogen like protein 2 in platelets.
Izhack Cherny, Pinhas Hasin, Lital Kalich Philosoph, Yael Shahal-Zimra, Ronit Gurion, Esther Rabizadeh.
PLoS One 2023 May; 18(5):e0285735.
Application:IP, Human, Platelet.
-
FGL2 deficiency alleviates maternal inflammation-induced blood-brain barrier damage by blocking PI3K/NF-κB mediated endothelial oxidative stress.
Lianjing Huang, Di Zhan, Ying Xing, Yaqin Yan, Qing Li, Jingyi Zhang, Sujuan Li, Qin Ning, Cai Zhang, Xiaoping Luo.
Frontiers in Immunology 2023 Mar; 14:1157027.
Application:IF, Mouse, Mouse brain.
-
Fibrinogen-like protein 2 promotes proinflammatory macrophage polarization and mitochondrial dysfunction in liver fibrosis.
Ran Tao, Meiwen Han, Wei Yuan, Fang Xiao, Jiaquan Huang, Xiaojing Wang, Xiaoping Luo, Weiming Yan, Xiaoyang Wan, Qin Ning.
International Immunopharmacology 2023 Apr; 117:109631.
Application:WB-Ce, Mouse, Mouse liver.
-
The Distinctive Role of Membrane Fibrinogen-like Protein 2 in the Liver Stage of Rodent Malaria Infections.
Shiming Jiao, Nie Tan, Chengyu Zhu, Yong Fu, Kun Zhang, Yan Ding, Wenyue Xu.
Parasite Immunology 2023 Jan; 45(1):e12956.
Application:WB-Ti, Mouse, Mouse liver.
-
Proteinase-activated receptor-1 antagonist attenuates brain injury via regulation of FGL2 and TLR4 after intracerebral hemorrhage in mice.
Xiaoying Yao, Yaying Song, Ze Wang, Shuwei Bai, Haojun Yu, Yishu Wang, Yangtai Guan.
Neuroscience 2022 Feb; 490:193.
Application:WB-Ti, Mouse, Mosue striatum.
-
FGL2-MCOLN3-Autophagy Axis-Triggered Neutrophil Extracellular Traps Exacerbate Liver Injury in Fulminant Viral Hepatitis.
Xitang Li, Qiang Gao, Wenhui Wu, Suping Hai, Junjian Hu, Jie You, Da Huang, Hongwu Wang, Di Wu, Meifang Han, Dong Xi, Weiming Yan, Tao Chen, Xiaoping Luo, Qin Ning, Xiaojing Wang.
Cellular and Molecular Gastroenterology and Hepatology 2022 Aug; 14(5):1077.
Application:Flow Cyt, IF, WB-Ce, Mouse, Mouse liver.
-
Fc Receptor is Involved in Nk Cell Functional Anergy Induced by Miapaca2 Tumor Cell Line.
Yekaterina O Ostapchuk, Yuliya V Perfilyeva, Aikyn Kali, Raikhan Tleulieva, Oxana Yu Yurikova, Gulshan E Stanbekova, Boris V Karalnik, Nikolai N Belyaev.
Immunological Investigations 2020 Aug; 1.
Application:Blocking, Func, Human, K-562, MiaPaCa2-TT cells.
-
Fibrinogen-like protein 2 deficiency aggravates renal fibrosis by facilitating macrophage polarization.
Shun Wu, Meng Li, Feng Xu, Gui-Qing Li, Bo Han, Xian-Dong He, Shu-Jing Li, Qian-Hui He, Xin-Yue Lai, Shuo Zhou, Quan-You Zheng, Bo Guo, Jian Chen, Ke-Qin Zhang, Gui-Lian Xu.
Biomedicine & Pharmacotherapy 2020 Aug; 130:110468.
Application:Flow Cyt, IF, IHC-Fr, IHC-P, WB-Ti, Mouse, Mouse bone marrow-derived macrophages, Mouse kidney.
-
Fibrinogen-like protein 2 aggravates nonalcoholic steatohepatitis via interaction with TLR4, eliciting inflammation in macrophages and inducing hepatic lipid metabolism disorder.
Junjian Hu, Hongwu Wang, Xitang Li, Yonggang Liu, Yuqiang Mi, Hongyan Kong, Dong Xi, Weiming Yan, Xiaoping Luo, Qin Ning, Xiaojing Wang.
Theranostics 2020 Aug; 10(21):9702.
Application:Flow Cyt, IF, IHC-P, IP, WB-Ti, WB-Tr, Human, Mouse, Human livers, Mouse livers, THP-1 cells.
-
Signaling through the Inhibitory Fc Receptor FcγRIIB Induces CD8+ T Cell Apoptosis to Limit T Cell Immunity.
Morris AB, Farley CR, Pinelli DF, Adams LE, Cragg MS, Boss JM, Scharer CD, Fribourg M, Cravedi P, Heeger PS, Ford ML.
Immunity 2020 Jan; 52(1):136.
Application:Flow Cyt, Mouse, Mouse splenocytes.
-
Genome-wide Analyses of Chromatin State in Human Mast Cells Reveal Molecular Drivers and Mediators of Allergic and Inflammatory Diseases.
Cildir G, Toubia J, Yip KH, Zhou M, Pant H, Hissaria P, Zhang J, Hong W, Robinson N, Grimbaldeston MA, Lopez AF, Tergaonkar V.
Immunity 2019 Nov; 51(5):949.
Application:IF, Human, Skin.
-
Control of Intestinal Inflammation, Colitis-Associated Tumorigenesis, and Macrophage Polarization by Fibrinogen-Like Protein 2.
Zhu Y, Zhou J, Feng Y, Chen L, Zhang L, Yang F, Zha H, Wang X, Han X, Shu C, Wan YY, Li QJ, Guo B, Zhu B.
Frontiers in Immunology 2018 Jan; 9:87.
Application:IF, IHC-Fr, WB-Ti, Mouse, Mouse colonic tissue.
-
Von Willebrand factor protects against acute CCl4-induced hepatotoxicity through phospho-p38 MAPK signaling pathway inhibition.
Sun HJ, Chen J, Zhang H, Ni B, van Velkinburgh JC, Liu Y, Wu YZ, Yang X.
Immunologic Research 2017 Oct; 65(5):1046.
Application:WB-Ce, WB-Ti, Human, Mouse, HUVEC, Mouse liver.
-
Adenovirus-Mediated artificial miRNA against Human Fibrinogen Like Protein 2 Inhibits Hepatocellular Carcinoma Growth.
Wang M, Liu J, Xi D, Luo X, Ning Q.
The Journal of Gene Medicine 2016 Jul; 18(7):102.
Application:IHC, WB-Ce, WB-Ti, Human, HCCLM6 cells, Human hepatocellular carcinoma.
-
Sodium tanshinone IIA sulfonate ameliorates experimental coronary no-reflow phenomenon through down-regulation of FGL2.
Long R, You Y, Li W, Jin N, Huang S, Li T, Liu K, Wang Z.
Life Sciences 2015 Dec; 142:8.
Application:WB-Ce, WB-Ti, Rat, Heart, CMECs.
-
Soluble FGL2, a novel effector molecule of activated hepatic stellate cells, regulates T-cell function in cirrhotic patients with hepatocellular carcinoma.
Sun Y, Xi D, Ding W, Wang F, Zhou H, Ning Q.
Hepatology International 2014 Sep; 8(4):567.
Application:Flow Cyt, IF, WB-Ce, Human, Liver, LX2 cells.
-
C5a/C5aR pathway is essential for the pathogenesis of murine viral fulminant hepatitis via potentiating Fgl2/fibroleukin expression.
Xu GL, Chen J, Yang F, Li GQ, Zheng LX, Wu YZ.
Hepatology 2014 Jul; 60(1):114.
Application:IHC, WB-Ce, Human, Liver tissues .
-
Treg cells expressing the coinhibitory molecule TIGIT selectively inhibit proinflammatory Th1 and Th17 cell responses.
Nicole Joller, Ester Lozano, Patrick R Burkett, Bonny Patel, Sheng Xiao, Chen Zhu, Junrong Xia, Tze G Tan, Esen Sefik, Vijay Yajnik, Arlene H Sharpe, Francisco J Quintana, Diane Mathis, Christophe Benoist, David A Hafler, Vijay K Kuchroo.
Immunity 2014 Apr; 40(4):569.
Application:Neutralization, Human, Mouse, Human T cells, Mouse Treg cells.
-
Novel Antibody against a Glutamic Acid-Rich Human Fibrinogen-Like Protein 2-Derived Peptide near Ser91 Inhibits hfgl2 Prothrombinase Activity.
Li WZ, Wang J, Long R, Su GH, Bukhory DK, Dai J, Jin N, Huang SY, Jia P, Li T, Fan C, Liu K, Wang Z.
PLoS One 2014 Apr; 9(4):e94551.
Application:IS, WB-Ce, WB-Tr, Human, HUVECs.
-
Intestinal and peripheral fibrinogen-like protein 2 expression in inflammatory bowel disease.
Dong X, Ye X, Chen X, Chen T, Xie S, Li Q, Lin X, Huang Z.
Digestive Diseases and Sciences 2014 Apr; 59(4):769.
Application:IHC-P, WB-Ce, Human, Mucosal, PBMCs.
-
Combined Adenovirus-Mediated Artificial microRNAs Targeting mfgl2, mFas, and mTNFR1 Protect against Fulminant Hepatic Failure in Mice.
Xi D, Wang M, Ye H, Luo X, Ning Q.
PLoS One 2013 Nov; 8(11):e82330.
Application:WB-Ti, Mouse, Liver.
-
Correlation of fibrinogen-like protein 2 with disease progression in patients with severe acute pancreatitis.
Ye X, Huai J, Chen R, Ding J, Chen Y, Cai Z.
Experimental and Therapeutic Medicine 2014 Jan; 7(1):85.
Application:IHC-P, Human, Pancreatic, PBMCs.
-
FGL2/Fibroleukin Mediates Hepatic Reperfusion Injury by Induction of Sinusoidal Endothelial Cell and Hepatocyte Apoptosis in Mice.
Selzner N, Liu H, Boehnert MU, Adeyi OA, Shalev I, Bartczak AM, Xue-Zhong M, Manuel J, Rotstein OD, McGilvray ID, Grant DR, Phillips MJ, Levy GA, Selzner M.
Journal of Hepatology 2012 Jan; 56(1):153.
Application:Injected, Mouse, Recombinant protein.
-
The FGL2/fibroleukin prothrombinase is involved in alveolar macrophage activation in COPD through the MAPK pathway.
Liu Y, Xu S, Xiao F, Xiong Y, Wang X, Gao S, Yan W, Ning Q.
Biochemical and Biophysical Research Communications 2010 May; 396(2):555.
Application:Flow Cyt, IHC-P, Human, Lungs, Mononuclear cells.
-
The novel CD4+CD25+ regulatory T cell effector molecule fibrinogen-like protein 2 contributes to the outcome of murine fulminant viral hepatitis.
Shalev I, Wong KM, Foerster K, Zhu Y, Chan C, Maknojia A, Zhang J, Ma XZ, Yang XC, Gao JF, Liu H, Selzner N, Clark DA, Adeyi O, Phillips MJ, Gorczynski RR, Grant D, McGilvray I, Levy G.
Hepatology 2009 Feb; 49(2):387.
Application:Func, IA, Mouse, Mouse T cells.
-
Targeted Deletion of fgl2 Leads to Impaired Regulatory T Cell Activity and Development of Autoimmune Glomerulonephritis1.
Shalev I, Liu H, Koscik C, Bartczak A, Javadi M, Wong KM, Maknojia A, He W, Liu MF, Diao J, Winter E, Manuel J, McCarthy D, Cattral M, Gommerman J, Clark DA, Phillips MJ, Gorczynski RR, Zhang L, Downey G, Grant D, Cybulsky MI, Levy G.
Journal of Immunology 2008 Jan; 180(1):249.
Application:Blocking, Mouse, CD4+ effector T cells and CD4+ CD25 Treg cells.
-
Expression of Prothrombin and Protease Activated Receptors in Human Myometrium During Pregnancy and Labor.
O'brien M, Morrison JJ, Smith TJ.
Biology of Reproduction 2007 Sep; 78(1):20.
Application:WB, Human, Human myometrium.
-
FGL2 promotes tumour growth and attenuates infiltration of activated immune cells in melanoma and ovarian cancer models.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com