FGL2 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FGL2 protein.
Immunogen
FGL2 (NP_006673.1, 1 a.a. ~ 439 a.a) full-length human protein.
Sequence
MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (77)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FGL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FGL2 expression in human colon.Western Blot (Cell lysate)
FGL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FGL2 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of FGL2 expression in transfected 293T cell line (H00010875-T02) by FGL2 MaxPab polyclonal antibody.
Lane 1: FGL2 transfected lysate(50.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of FGL2 transfected lysate using anti-FGL2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGL2 purified MaxPab mouse polyclonal antibody (B01P) (H00010875-B01P). -
Gene Info — FGL2
Entrez GeneID
10875GeneBank Accession#
NM_006682.2Protein Accession#
NP_006673.1Gene Name
FGL2
Gene Alias
T49, pT49
Gene Description
fibrinogen-like 2
Omim ID
605351Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq
Other Designations
fibrinogen-like protein 2|fibroleukin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com