Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL27 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010850-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CCL27 protein.
  • Immunogen:
  • CCL27 (NP_006655.1, 1 a.a. ~ 112 a.a) full-length human protein.
  • Sequence:
  • MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CCL27 expression in transfected 293T cell line (H00010850-T01) by CCL27 MaxPab polyclonal antibody.

    Lane 1: CCL27 transfected lysate(12.60 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • CCL27
  • Gene Alias:
  • ALP,CTACK,CTAK,ESKINE,ILC,PESKY,SCYA27
  • Gene Description:
  • chemokine (C-C motif) ligand 27
  • Gene Summary:
  • This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq
  • Other Designations:
  • CC chemokine ILC,IL-11 Ralpha-locus chemokine,OTTHUMP00000000533,OTTHUMP00000021297,cutaneous T-cell attracting chemokine,skinkine,small inducible cytokine A27,small inducible cytokine subfamily A (Cys-Cys), member 27
  • RSS
  • YouTube
  • Linkedin
  • Facebook