Product Browser

Last updated: 2017/1/22
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1R13L polyclonal antibody (A01)

  • Catalog # : H00010848-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPP1R13L.
  • Immunogen:
  • PPP1R13L (NP_006654, 253 a.a. ~ 351 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010848-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PPP1R13L
  • Gene Alias:
  • IASPP,NKIP1,RAI
  • Gene Description:
  • protein phosphatase 1, regulatory (inhibitor) subunit 13 like
  • Gene Summary:
  • IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53.[supplied by OMIM
  • Other Designations:
  • NFkB interacting protein 1,RelA-associated inhibitor,inhibitor of apoptosis stimulating protein of p53,protein phosphatase 1, regulatory subunit 13 like
  • RSS
  • YouTube
  • Linkedin
  • Facebook