Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDE10A polyclonal antibody (A01)

  • Catalog # : H00010846-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PDE10A.
  • Immunogen:
  • PDE10A (NP_006652, 242 a.a. ~ 333 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010846-A01
    Western Blot detection against Immunogen (36.23 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PDE10A
  • Gene Alias:
  • FLJ11894,FLJ25677,HSPDE10A
  • Gene Description:
  • phosphodiesterase 10A
  • Gene Summary:
  • Various cellular responses are regulated by the second messengers cAMP and cGMP. Phosphodiesterases, such as PDE10A, eliminate cAMP- and cGMP-mediated intracellular signaling by hydrolyzing the cyclic nucleotide to the corresponding nucleoside 5-prime monophosphate (Fujishige et al., 2000 [PubMed 10998054]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000017586,dJ416F21.1 (phosphodiesterase 10A),phosphodiesterase 10A1 (PDE10A1)
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook