Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CPLX2 (Human) Recombinant Protein (P01)

  • Catalog # : H00010814-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CPLX2 full-length ORF ( ADR82826.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 14.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CPLX2
  • Gene Alias:
  • 921-L,CPX-2,CPX2,Hfb1,MGC138492
  • Gene Description:
  • complexin 2
  • Gene Summary:
  • Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • synaphin 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook