Product Browser

Last updated: 2017/10/15
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GJB6 polyclonal antibody (A01)

  • Catalog # : H00010804-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GJB6.
  • Immunogen:
  • GJB6 (AAH38934, 45 a.a. ~ 75 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GDEQEDFVCNTLQPGCKNVCYDHFFPVSHIR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010804-A01
    Western Blot detection against Immunogen (29.52 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • GJB6
  • Gene Alias:
  • CX30,DFNA3,ED2,EDH,HED
  • Gene Description:
  • gap junction protein, beta 6, 30kDa
  • Gene Summary:
  • Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extracellular loops, a cytoplasmic loop formed between the two inner transmembrane segments, and the N- and C-terminus both being in the cytoplasm. The specificity of the gap junction is determined by which connexin proteins comprise the hemichannel. In the past, connexin protein names were based on their molecular weight, however the new nomenclature uses sequential numbers based on which form (alpha or beta) of the gap junction is present. This gene encodes one of the connexin proteins. Mutations in this gene have been found in some forms of deafness and in some families with hidrotic ectodermal dysplasia. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018096,OTTHUMP00000176870,OTTHUMP00000176871,OTTHUMP00000176872,connexin 30,ectodermal dysplasia 2, hidrotic (Clouston syndrome),gap junction protein, beta 6,gap junction protein, beta 6 (connexin 30)
  • RSS
  • YouTube
  • Linkedin
  • Facebook