SEPT9 monoclonal antibody (M01), clone 2C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEPT9 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SEPT9.
Immunogen
SEPT9 (AAH21192, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEPT9 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SEPT9
Entrez GeneID
10801GeneBank Accession#
BC021192Protein Accession#
AAH21192Gene Name
SEPT9
Gene Alias
AF17q25, FLJ75490, KIAA0991, MSF, MSF1, NAPB, PNUTL4, SINT1, SeptD1
Gene Description
septin 9
Gene Ontology
HyperlinkGene Summary
This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described
Other Designations
MLL septin-like fusion|Ov/Br septin|ovarian/breast septin|septin D1
-
Interactome
-
Disease
-
Publication Reference
-
Promoter methylation of SEPT9 as a potential biomarker for early detection of cervical cancer and its overexpression predicts radioresistance.
Jiao X, Zhang S, Jiao J, Zhang T, Qu W, Muloye GM, Kong B, Zhang Q, Cui B.
Clinical Epigenetics 2019 Aug; 11(1):120.
Application：IF, IHC-P, WB-Ce, WB-Tr, Human, HeLa cells, Human cervical cancer.
-
A SEPT1-based scaffold is required for Golgi integrity and function.
Song K, Gras C, Capin G, Gimber N, Lehmann M, Mohd S, Puchkov D, Rödiger M, Wilhelmi I, Daumke O, Schmoranzer J, Schürmann A, Krauss M.
Journal of Cell Science 2019 Feb; 132(3): jcs225557.
Application：IF, Human, HeLa cells.
-
SEPT9 negatively regulates ubiquitin-dependent downregulation of EGFR.
Diesenberg K, Beerbaum M, Fink U, Schmieder P, Krauss M.
Journal of Cell Science 2015 Jan; 128(2):397.
Application：IF, WB-Ce, WB-Tr, Human, HeLa, A431 cells.
-
Promoter methylation of SEPT9 as a potential biomarker for early detection of cervical cancer and its overexpression predicts radioresistance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com