SEPT9 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SEPT9 polyclonal antibody (A01), Lot # ABNOVA060629QCS1 Western Blot analysis of SEPT9 expression in PC-12 ( Cat # L012V1 ).
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SEPT9.
Immunogen
SEPT9 (AAH21192, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Sequence
PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SEPT9 polyclonal antibody (A01), Lot # ABNOVA060629QCS1 Western Blot analysis of SEPT9 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SEPT9
Entrez GeneID
10801GeneBank Accession#
BC021192Protein Accession#
AAH21192Gene Name
SEPT9
Gene Alias
AF17q25, FLJ75490, KIAA0991, MSF, MSF1, NAPB, PNUTL4, SINT1, SeptD1
Gene Description
septin 9
Gene Ontology
HyperlinkGene Summary
This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described
Other Designations
MLL septin-like fusion|Ov/Br septin|ovarian/breast septin|septin D1
-
Interactome
-
Disease
-
Publication Reference
-
The Influence of Methylated Septin 9 Gene on RNA and Protein Level in Colorectal Cancer.
Toth K, Galamb O, Spisak S, Wichmann B, Sipos F, Valcz G, Leiszter K, Molnar B, Tulassay Z.
Pathology Oncology Research 2011 Sep; 17(3):503.
Application：IHC, Human, Villous adenoma, Colorectal cancer tissues, HT29 cells.
-
The Influence of Methylated Septin 9 Gene on RNA and Protein Level in Colorectal Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com