RPP40 monoclonal antibody (M03), clone 1G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RPP40 expression in transfected 293T cell line by RPP40 monoclonal antibody (M03), clone 1G8.
Lane 1: RPP40 transfected lysate (Predicted MW: 28 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPP40 is 0.1 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPP40.
Immunogen
RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (76)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RPP40 expression in transfected 293T cell line by RPP40 monoclonal antibody (M03), clone 1G8.
Lane 1: RPP40 transfected lysate (Predicted MW: 28 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPP40 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — RPP40
Entrez GeneID
10799GeneBank Accession#
NM_006638Protein Accession#
NP_006629Gene Name
RPP40
Gene Alias
RNASEP1, bA428J1.3
Gene Description
ribonuclease P/MRP 40kDa subunit
Omim ID
606117Gene Ontology
HyperlinkGene Summary
40kD subunit|ribonuclease P1
Other Designations
ribonuclease P (40 kD)|ribonuclease P 40kDa subunit|ribonuclease P, 40kD subunit|ribonuclease P1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com