WDR4 monoclonal antibody (M01), clone 1F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
WDR4 monoclonal antibody (M01), clone 1F9 Western Blot analysis of WDR4 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of WDR4 expression in transfected 293T cell line by WDR4 monoclonal antibody (M01), clone 1F9.
Lane 1: WDR4 transfected lysate (Predicted MW: 45.5 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to WDR4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDR4 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (55 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant WDR4.
Immunogen
WDR4 (AAH01074, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTSVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (68)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
WDR4 monoclonal antibody (M01), clone 1F9 Western Blot analysis of WDR4 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of WDR4 expression in transfected 293T cell line by WDR4 monoclonal antibody (M01), clone 1F9.
Lane 1: WDR4 transfected lysate (Predicted MW: 45.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to WDR4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDR4 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — WDR4
Entrez GeneID
10785GeneBank Accession#
BC001074Protein Accession#
AAH01074Gene Name
WDR4
Gene Alias
TRM82
Gene Description
WD repeat domain 4
Omim ID
605924Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
WD repeat domain 4 protein|WD repeat-containing protein 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com