ZNF274 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ZNF274 partial ORF ( NP_598009, 420 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.95
Interspecies Antigen Sequence
Mouse (41); Rat (39)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ZNF274
Entrez GeneID
10782GeneBank Accession#
NM_133502Protein Accession#
NP_598009Gene Name
ZNF274
Gene Alias
DKFZp686K08243, FLJ37843, HFB101, ZF2, ZKSCAN19
Gene Description
zinc finger protein 274
Omim ID
605467Gene Ontology
HyperlinkGene Summary
This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals. [provided by RefSeq
Other Designations
KRAB zinc finger protein HFB101|zinc finger protein zfp2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com