ZNF274 monoclonal antibody (M04), clone 1D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZNF274.
Immunogen
ZNF274 (NP_598009, 420 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (41); Rat (39)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZNF274 expression in transfected 293T cell line by ZNF274 monoclonal antibody (M04), clone 1D8.
Lane 1: ZNF274 transfected lysate(74.2 KDa).
Lane 2: Non-transfected lysate.
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ZNF274 over-expressed 293 cell line, cotransfected with ZNF274 Validated Chimera RNAi ( Cat # H00010782-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF274 monoclonal antibody (M04), clone 1D8 (Cat # H00010782-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to ZNF274 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ZNF274
Entrez GeneID
10782GeneBank Accession#
NM_133502Protein Accession#
NP_598009Gene Name
ZNF274
Gene Alias
DKFZp686K08243, FLJ37843, HFB101, ZF2, ZKSCAN19
Gene Description
zinc finger protein 274
Omim ID
605467Gene Ontology
HyperlinkGene Summary
This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals. [provided by RefSeq
Other Designations
KRAB zinc finger protein HFB101|zinc finger protein zfp2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com