TRAF3IP2 monoclonal antibody (M01), clone 4A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TRAF3IP2 monoclonal antibody (M01), clone 4A3 Western Blot analysis of TRAF3IP2 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TRAF3IP2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRAF3IP2 is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TRAF3IP2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (38.39 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRAF3IP2.
Immunogen
TRAF3IP2 (AAH02823, 451 a.a. ~ 565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.39 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TRAF3IP2 monoclonal antibody (M01), clone 4A3 Western Blot analysis of TRAF3IP2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TRAF3IP2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRAF3IP2 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TRAF3IP2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TRAF3IP2
Entrez GeneID
10758GeneBank Accession#
BC002823Protein Accession#
AAH02823Gene Name
TRAF3IP2
Gene Alias
ACT1, C6orf2, C6orf4, C6orf5, C6orf6, CIKS, DKFZp586G0522, MGC3581
Gene Description
TRAF3 interacting protein 2
Omim ID
607043Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene. [provided by RefSeq
Other Designations
NFkB-activating protein ACT1|OTTHUMP00000017022|OTTHUMP00000017024|OTTHUMP00000040422|connection to IKK and SAPK/JNK
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com