Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RGS19IP1 polyclonal antibody (A02)

  • Catalog # : H00010755-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GIPC1.
  • Immunogen:
  • GIPC1 (NP_005707, 61 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010755-A02
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • RGS19IP1 polyclonal antibody (A02), Lot # 050928JC01 Western Blot analysis of GIPC1 expression in 293 ( Cat # L026V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • GIPC1
  • Gene Alias:
  • C19orf3,GIPC,GLUT1CBP,Hs.6454,IIP-1,MGC15889,MGC3774,NIP,RGS19IP1,SEMCAP,SYNECTIIN,SYNECTIN,TIP-2
  • Gene Description:
  • GIPC PDZ domain containing family, member 1
  • Gene Summary:
  • GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM
  • Other Designations:
  • GLUT1 C-terminal binding protein,IGF-1 receptor interacting protein 1,regulator of G-protein signalling 19 interacting protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook