CHL1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CHL1 partial ORF ( NP_006605, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (84)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CHL1
Entrez GeneID
10752GeneBank Accession#
NM_006614Protein Accession#
NP_006605Gene Name
CHL1
Gene Alias
CALL, FLJ44930, L1CAM2, MGC132578
Gene Description
cell adhesion molecule with homology to L1CAM (close homolog of L1)
Omim ID
607416Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the L1 gene family of neural cell adhesion molecules. It is a neural recognition molecule that may be involved in signal transduction pathways. The deletion of one copy of this gene may be responsible for mental defects in patients with 3p- syndrome. Several alternatively spliced transcript variants of this gene have been described, but their full length nature is not known. [provided by RefSeq
Other Designations
L1 cell adhesion molecule 2|cell adhesion molecule L1-like|cell adhesion molecule with homology to L1CAM|cell adhesion molecule with homology to L1CAM (close homologue of L1)|neural cell adhesion molecule
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com