CHL1 monoclonal antibody (M02), clone 2H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHL1 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CHL1.
Immunogen
CHL1 (NP_006605, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHL1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — CHL1
Entrez GeneID
10752GeneBank Accession#
NM_006614Protein Accession#
NP_006605Gene Name
CHL1
Gene Alias
CALL, FLJ44930, L1CAM2, MGC132578
Gene Description
cell adhesion molecule with homology to L1CAM (close homolog of L1)
Omim ID
607416Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the L1 gene family of neural cell adhesion molecules. It is a neural recognition molecule that may be involved in signal transduction pathways. The deletion of one copy of this gene may be responsible for mental defects in patients with 3p- syndrome. Several alternatively spliced transcript variants of this gene have been described, but their full length nature is not known. [provided by RefSeq
Other Designations
L1 cell adhesion molecule 2|cell adhesion molecule L1-like|cell adhesion molecule with homology to L1CAM|cell adhesion molecule with homology to L1CAM (close homologue of L1)|neural cell adhesion molecule
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com