CHL1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CHL1.
Immunogen
CHL1 (NP_006605, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag.
Sequence
EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CHL1 polyclonal antibody (A01), Lot # SAC4060428QCS1 Western Blot analysis of CHL1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — CHL1
Entrez GeneID
10752GeneBank Accession#
NM_006614Protein Accession#
NP_006605Gene Name
CHL1
Gene Alias
CALL, FLJ44930, L1CAM2, MGC132578
Gene Description
cell adhesion molecule with homology to L1CAM (close homolog of L1)
Omim ID
607416Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the L1 gene family of neural cell adhesion molecules. It is a neural recognition molecule that may be involved in signal transduction pathways. The deletion of one copy of this gene may be responsible for mental defects in patients with 3p- syndrome. Several alternatively spliced transcript variants of this gene have been described, but their full length nature is not known. [provided by RefSeq
Other Designations
L1 cell adhesion molecule 2|cell adhesion molecule L1-like|cell adhesion molecule with homology to L1CAM|cell adhesion molecule with homology to L1CAM (close homologue of L1)|neural cell adhesion molecule
-
Interactome
-
Disease
-
Publication Reference
-
Interaction between DISC1 and CHL1 in regulation of neurite outgrowth.
Ren J, Zhao T, Xu Y, Ye H.
Brain Research 2016 Oct; 1648(Pt A):290.
Application:IF, Mouse, Cortical Neurons.
-
CHL1 negatively regulates the proliferation and neuronal differentiation of neural progenitor cells through activation of the ERK1/2 MAPK pathway.
Huang X, Zhu LL, Zhao T, Wu LY, Wu KW, Schachner M, Xiao ZC, Fan M.
Molecular and Cellular Neurosciences 2011 Jan; 46(1):296.
Application:ICC, Mouse, Mouse neural progenitor cells.
-
Neural recognition molecules CHL1 and NB-3 regulate apical dendrite orientation in the neocortex via PTPalpha.
Ye H, Tan YL, Ponniah S, Takeda Y, Wang SQ, Schachner M, Watanabe K, Pallen CJ, Xiao ZC.
The EMBO Journal 2007 Nov; 27(1):188.
Application:IF, WB, Mouse, Mouse brain.
-
Interaction between DISC1 and CHL1 in regulation of neurite outgrowth.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com