Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAI1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010743-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RAI1 partial ORF ( NP_109590.3, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQSFRERCGFHGKQQNYQQTSQETSRLENYRQPSQAGLSCDRQRLLAKDYYNPQPYPSYEGGAGTPSGTAAAVAADKYHRGSKALPTQQGLQGRPAFPGYG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010743-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RAI1
  • Gene Alias:
  • DKFZp434A139,KIAA1820,MGC12824,SMCR,SMS
  • Gene Description:
  • retinoic acid induced 1
  • Gene Summary:
  • This gene is located within the Smith-Magenis syndrome region on chromosome 17. It is highly similar to its mouse counterpart and is expressed at high levels mainly in neuronal tissues. The protein encoded by this gene includes a polymorphic polyglutamine tract in the N-terminal domain. Expression of the mouse counterpart in neurons is induced by retinoic acid. This gene is associated with both the severity of the phenotype and the response to medication in schizophrenic patients. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000065594
  • RSS
  • YouTube
  • Linkedin
  • Facebook