RAI1 monoclonal antibody (M01), clone 6H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RAI1 monoclonal antibody (M01), clone 6H5. Western Blot analysis of RAI1 expression in Hela S3 NE.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAI1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.85 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAI1.
Immunogen
RAI1 (NP_109590.3, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQSFRERCGFHGKQQNYQQTSQETSRLENYRQPSQAGLSCDRQRLLAKDYYNPQPYPSYEGGAGTPSGTAAAVAADKYHRGSKALPTQQGLQGRPAFPGYG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAI1 monoclonal antibody (M01), clone 6H5. Western Blot analysis of RAI1 expression in Hela S3 NE.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAI1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — RAI1
Entrez GeneID
10743GeneBank Accession#
NM_030665Protein Accession#
NP_109590.3Gene Name
RAI1
Gene Alias
DKFZp434A139, KIAA1820, MGC12824, SMCR, SMS
Gene Description
retinoic acid induced 1
Gene Ontology
HyperlinkGene Summary
This gene is located within the Smith-Magenis syndrome region on chromosome 17. It is highly similar to its mouse counterpart and is expressed at high levels mainly in neuronal tissues. The protein encoded by this gene includes a polymorphic polyglutamine tract in the N-terminal domain. Expression of the mouse counterpart in neurons is induced by retinoic acid. This gene is associated with both the severity of the phenotype and the response to medication in schizophrenic patients. [provided by RefSeq
Other Designations
OTTHUMP00000065594
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com