Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBBP9 polyclonal antibody (A01)

  • Catalog # : H00010741-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RBBP9.
  • Immunogen:
  • RBBP9 (NP_006597, 87 a.a. ~ 185 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • THRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010741-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RBBP9
  • Gene Alias:
  • BOG,MGC9236,RBBP10
  • Gene Description:
  • retinoblastoma binding protein 9
  • Gene Summary:
  • The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. [provided by RefSeq
  • Other Designations:
  • B5T overexpressed gene protein,OTTHUMP00000030360,retinoblastoma-binding protein 9,retinoma-binding protein 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook