Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NFAT5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010725-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NFAT5 partial ORF ( NP_006590, 1422 a.a. - 1531 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010725-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NFAT5
  • Gene Alias:
  • KIAA0827,NF-AT5,NFATL1,NFATZ,OREBP,TONEBP
  • Gene Description:
  • nuclear factor of activated T-cells 5, tonicity-responsive
  • Gene Summary:
  • The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • NFAT-like protein 1,T cell transcription factor NFAT5,TonE-binding protein,glutamine rich protein H65,nuclear factor of activated T-cells 5,osmotic response element-binding protein,tonicity-responsive enhancer binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook