LASS1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LASS1 partial ORF ( NP_067090.1, 301 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.24
Interspecies Antigen Sequence
Mouse (82); Rat (80)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LASS1
Entrez GeneID
10715GeneBank Accession#
NM_021267Protein Accession#
NP_067090.1Gene Name
LASS1
Gene Alias
CerS1, LAG1, MGC90349, UOG1
Gene Description
LAG1 homolog, ceramide synthase 1
Omim ID
606919Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1. [provided by RefSeq
Other Designations
LAG1 longevity assurance homolog 1|longevity assurance (LAG1, S. cerevisiae) homolog 1|longevity assurance gene 1|upstream of GDF1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com