LASS1 monoclonal antibody (M04), clone 3F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
LASS1 monoclonal antibody (M04), clone 3F9. Western Blot analysis of LASS1 expression in HepG2.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LASS1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (31.24 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LASS1.
Immunogen
LASS1 (NP_067090.1, 301 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (80)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.24 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LASS1 monoclonal antibody (M04), clone 3F9. Western Blot analysis of LASS1 expression in HepG2.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LASS1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — LASS1
Entrez GeneID
10715GeneBank Accession#
NM_021267Protein Accession#
NP_067090.1Gene Name
LASS1
Gene Alias
CerS1, LAG1, MGC90349, UOG1
Gene Description
LAG1 homolog, ceramide synthase 1
Omim ID
606919Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1. [provided by RefSeq
Other Designations
LAG1 longevity assurance homolog 1|longevity assurance (LAG1, S. cerevisiae) homolog 1|longevity assurance gene 1|upstream of GDF1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com