LASS1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant LASS1.
Immunogen
LASS1 (NP_067090, 301 a.a. ~ 350 a.a) partial recombinant protein with GST tag.
Sequence
YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (80)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.61 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — LASS1
Entrez GeneID
10715GeneBank Accession#
NM_021267Protein Accession#
NP_067090Gene Name
LASS1
Gene Alias
CerS1, LAG1, MGC90349, UOG1
Gene Description
LAG1 homolog, ceramide synthase 1
Omim ID
606919Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1. [provided by RefSeq
Other Designations
LAG1 longevity assurance homolog 1|longevity assurance (LAG1, S. cerevisiae) homolog 1|longevity assurance gene 1|upstream of GDF1
-
Interactome
-
Publication Reference
-
Alternative splicing of ceramide synthase 2 alters levels of specific ceramides and modulates cancer cell proliferation and migration in Luminal B breast cancer subtype.
Trishna Pani, Kajal Rajput, Animesh Kar, Harsh Sharma, Rituparna Basak, Nihal Medatwal, Sandhini Saha, Gagan Dev, Sharwan Kumar, Siddhi Gupta, Arnab Mukhopadhyay, Dipankar Malakar, Tushar Kanti Maiti, Aneeshkumar G Arimbasseri, S V S Deo, Ravi Datta Sharma, Avinash Bajaj, Ujjaini Dasgupta.
Cell Death & Disease 2021 Feb; 12(2):171.
Application:WB-Tr, Human, BT-474 cells.
-
CLN5 and CLN8 protein association with ceramide synthase: biochemical and proteomic approaches.
Haddad SE, Khoury M, Daoud M, Kantar R, Harati H, Mousallem T, Alzate O, Meyer B, Boustany RM.
Electrophoresis 2012 Dec; 33(24):3798.
Application:IP, Human, Human fibroblasts.
-
siRNA-mediated down-regulation of ceramide synthase 1 leads to apoptotic resistance in human head and neck squamous carcinoma cells after photodynamic therapy.
Separovic D, Breen P, Joseph N, Bielawski J, Pierce JS, VAN Buren E, Gudz TI.
Anticancer research 2012 Jul; 32(7):2479.
Application:WB-Tr, Human, UM-SCC-22A cells.
-
Ceramide synthase 6 knockdown suppresses apoptosis after photodynamic therapy in human head and neck squamous carcinoma cells.
Separovic D, Breen P, Joseph N, Bielawski J, Pierce JS, VAN Buren E, Gudz TI.
Anticancer Research 2012 Mar; 32(3):753.
Application:WB-Ce, Human, Treated UM-SCC-22A.
-
Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways.
Senkal CE, Ponnusamy S, Bielawski J, Hannun YA, Ogretmen B.
FASEB Journal 2010 Jan; 24(1):296.
Application:WB, Human, HNSCC cells.
-
Role of human longevity assurance gene 1 and C18-ceramide in chemotherapy-induced cell death in human head and neck squamous cell carcinomas.
Senkal CE, Ponnusamy S, Rossi MJ, Bialewski J, Sinha D, Jiang JC, Jazwinski SM, Hannun YA, Ogretmen B.
Molecular Cancer Therapeutics 2007 Feb; 6(2):712.
Application:WB, Human, Human head and neck squamous cell carcinomas, UM-SCC-22A cells.
-
Alternative splicing of ceramide synthase 2 alters levels of specific ceramides and modulates cancer cell proliferation and migration in Luminal B breast cancer subtype.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com