Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LASS1 polyclonal antibody (A01)

  • Catalog # : H00010715-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LASS1.
  • Immunogen:
  • LASS1 (NP_067090, 301 a.a. ~ 350 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010715-A01
    Western Blot detection against Immunogen (31.61 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • LASS1
  • Gene Alias:
  • CerS1,LAG1,MGC90349,UOG1
  • Gene Description:
  • LAG1 homolog, ceramide synthase 1
  • Gene Summary:
  • This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1. [provided by RefSeq
  • Other Designations:
  • LAG1 longevity assurance homolog 1,longevity assurance (LAG1, S. cerevisiae) homolog 1,longevity assurance gene 1,upstream of GDF1
  • RSS
  • YouTube
  • Linkedin
  • Facebook