Product Browser

Last updated: 2017/1/15
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CORIN polyclonal antibody (A01)

  • Catalog # : H00010699-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CORIN.
  • Immunogen:
  • CORIN (NP_006578, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010699-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CORIN
  • Gene Alias:
  • ATC2,CRN,Lrp4,MGC119742,TMPRSS10
  • Gene Description:
  • corin, serine peptidase
  • Gene Summary:
  • This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. [provided by RefSeq
  • Other Designations:
  • atrial natriuteric peptide-converting enzyme,corin,corin, serine protease,heart specific serine proteinase,pro-ANP-convertase,pro-ANP-converting enzyme
  • RSS
  • YouTube
  • Linkedin
  • Facebook