CLDN16 monoclonal antibody (M02), clone 1F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CLDN16 expression in transfected 293T cell line by CLDN16 monoclonal antibody (M02), clone 1F2.
Lane 1: CLDN16 transfected lysate(33.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CLDN16 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.77 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CLDN16.
Immunogen
CLDN16 (NP_006571, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.77 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CLDN16 expression in transfected 293T cell line by CLDN16 monoclonal antibody (M02), clone 1F2.
Lane 1: CLDN16 transfected lysate(33.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CLDN16 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — CLDN16
Entrez GeneID
10686GeneBank Accession#
NM_006580Protein Accession#
NP_006571Gene Name
CLDN16
Gene Alias
HOMG3, PCLN1
Gene Description
claudin 16
Gene Ontology
HyperlinkGene Summary
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. [provided by RefSeq
Other Designations
hypomagnesemia 3, with hypercalciuria and nephrocalcinosis|paracellin-1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com