Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GNB5 (Human) Recombinant Protein (P01)

  • Catalog # : H00010681-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GNB5 full-length ORF ( AAH11671, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKVRHCSQPRYRGFRIPAYLKVLWSSCPALS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010681-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • GNB5
  • Gene Alias:
  • FLJ37457,FLJ43714,GB5
  • Gene Description:
  • guanine nucleotide binding protein (G protein), beta 5
  • Gene Summary:
  • Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist. [provided by RefSeq
  • Other Designations:
  • G protein, beta subunit 5L,G protein, beta-5 subunit,guanine nucleotide-binding protein, beta subunit 5L,guanine nucleotide-binding protein, beta-5 subunit,transducin beta chain 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook