Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

B3GNT2 monoclonal antibody (M05), clone 1A8

  • Catalog # : H00010678-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant B3GNT2.
  • Immunogen:
  • B3GNT2 (NP_006568, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010678-M05
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of B3GNT2 expression in transfected 293T cell line by B3GNT2 monoclonal antibody (M05), clone 1A8.

    Lane 1: B3GNT2 transfected lysate(46.022 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged B3GNT2 is approximately 0.3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • B3GNT2
  • Gene Alias:
  • B3GN-T1,B3GN-T2,B3GNT,B3GNT-2,B3GNT1,BETA3GNT
  • Gene Description:
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
  • Gene Summary:
  • This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. [provided by RefSeq
  • Other Designations:
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1,beta-1,3-N-acetylglucosaminyltransferase bGnT-1,beta-1,3-N-acetylglucosaminyltransferase bGnT-2,beta3gal-T5
  • RSS
  • YouTube
  • Linkedin
  • Facebook