Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

B3GNT2 polyclonal antibody (A01)

  • Catalog # : H00010678-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant B3GNT2.
  • Immunogen:
  • B3GNT2 (NP_006568, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010678-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • B3GNT2
  • Gene Alias:
  • B3GN-T1,B3GN-T2,B3GNT,B3GNT-2,B3GNT1,BETA3GNT
  • Gene Description:
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
  • Gene Summary:
  • This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. [provided by RefSeq
  • Other Designations:
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1,beta-1,3-N-acetylglucosaminyltransferase bGnT-1,beta-1,3-N-acetylglucosaminyltransferase bGnT-2,beta3gal-T5
  • RSS
  • YouTube
  • Linkedin
  • Facebook