Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF13B (Human) Recombinant Protein (Q01)

  • Catalog # : H00010673-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFSF13B partial ORF ( AAH20674.1, 118 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.18
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010673-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TNFSF13B
  • Gene Alias:
  • BAFF,BLYS,CD257,DTL,TALL-1,TALL1,THANK,TNFSF20,ZTNF4
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 13b
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. [provided by RefSeq
  • Other Designations:
  • ApoL related ligand TALL-1,B-cell activating factor,B-lymphocyte stimulator,OTTHUMP00000018691,TNF and ApoL-related leukocyte expressed ligand 1,TNF homolog that activates apoptosis,delta BAFF,dendritic cell-derived TNF-like molecule,tumor necrosis factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook