KHDRBS1 monoclonal antibody (M03), clone 1A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
KHDRBS1 monoclonal antibody (M03), clone 1A4 Western Blot analysis of KHDRBS1 expression in A-431 ( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of KHDRBS1 expression in transfected 293T cell line by KHDRBS1 monoclonal antibody (M03), clone 1A4.
Lane 1: KHDRBS1 transfected lysate(41 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KHDRBS1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KHDRBS1 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to KHDRBS1 on A-431 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KHDRBS1.
Immunogen
KHDRBS1 (AAH00717, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KHDRBS1 monoclonal antibody (M03), clone 1A4 Western Blot analysis of KHDRBS1 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of KHDRBS1 expression in transfected 293T cell line by KHDRBS1 monoclonal antibody (M03), clone 1A4.
Lane 1: KHDRBS1 transfected lysate(41 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KHDRBS1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KHDRBS1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to KHDRBS1 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — KHDRBS1
Entrez GeneID
10657GeneBank Accession#
BC000717Protein Accession#
AAH00717Gene Name
KHDRBS1
Gene Alias
FLJ34027, Sam68, p62
Gene Description
KH domain containing, RNA binding, signal transduction associated 1
Omim ID
602489Gene Ontology
HyperlinkGene Summary
RNA binding
Other Designations
GAP-associated tyrosine phosphoprotein p62 (Sam68)|OTTHUMP00000004022
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com