Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAMKK2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010645-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CAMKK2 partial ORF ( AAH26060, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39.93
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010645-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CAMKK2
  • Gene Alias:
  • CAMKK,CAMKKB,KIAA0787,MGC15254
  • Gene Description:
  • calcium/calmodulin-dependent protein kinase kinase 2, beta
  • Gene Summary:
  • The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases. [provided by RefSeq
  • Other Designations:
  • CAMKK beta protein,calcium/calmodulin-dependent protein kinase beta,calcium/calmodulin-dependent protein kinase kinase 2 beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook