IMP-2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant IMP-2.
Immunogen
IMP-2 (NP_006539, 65 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
Sequence
HGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.66 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — IGF2BP2
Entrez GeneID
10644GeneBank Accession#
NM_006548Protein Accession#
NP_006539Gene Name
IGF2BP2
Gene Alias
IMP-2, IMP2, VICKZ2, p62
Gene Description
insulin-like growth factor 2 mRNA binding protein 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains several four KH domains and two RRM domains. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
IGF II mRNA binding protein 2|IGF-II mRNA-binding protein 2|insulin-like 2 growth factor 2-binding protein 2
-
Interactome
-
Disease
-
Publication Reference
-
Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
Rivera Vargas T, Boudoukha S, Simon A, Souidi M, Cuvellier S, Pinna G, Polesskaya A.
Oncogene 2014 May; 33(22):2866.
Application:IF, WB-Ce, Human, Cal27, Hep3B, HeyA8, HFS, MCF-7, RD, WI38 cells.
-
Role of the RNA-binding protein IMP-2 in muscle cell motility.
Boudoukha S, Cuvellier S, Polesskaya A.
Molecular and Cellular Biology 2010 Dec; 30(24):5710.
Application:IF, WB-Ce, WB-Tr, Human, Mouse, C2C12, Fibroblasts, RD cells.
-
Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com