LEFTY1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
LEFTY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of LEFTY1 expression in mouse liver.
Western Blot (Transfected lysate)
Western Blot analysis of LEFTY1 expression in transfected 293T cell line (H00010637-T02) by LEFTY1 MaxPab polyclonal antibody.
Lane 1: LEFTY1 transfected lysate(40.90 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human LEFTY1 protein.
Immunogen
LEFTY1 (NP_066277.1, 1 a.a. ~ 366 a.a) full-length human protein.
Sequence
MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (81); Rat (80)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
LEFTY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of LEFTY1 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of LEFTY1 expression in transfected 293T cell line (H00010637-T02) by LEFTY1 MaxPab polyclonal antibody.
Lane 1: LEFTY1 transfected lysate(40.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LEFTY1
Entrez GeneID
10637GeneBank Accession#
NM_020997Protein Accession#
NP_066277.1Gene Name
LEFTY1
Gene Alias
LEFTB, LEFTYB
Gene Description
left-right determination factor 1
Omim ID
603037Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene. [provided by RefSeq
Other Designations
OTTHUMP00000035572|left-right determination, factor B
-
Pathway
-
Disease
-
Publication Reference
-
Anti-inflammatory effects of Lefty-1 in renal tubulointerstitial inflammation via regulation of the NF-κB pathway.
Zhang L, Xu C, Hu W, Wu P, Qin C, Zhang J.
International Journal of Molecular Medicine 2018 Mar; 41(3):1293.
Application：WB, Rat, NRK‑52E cells.
-
Anti-inflammatory effects of Lefty-1 in renal tubulointerstitial inflammation via regulation of the NF-κB pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com