TGOLN2 monoclonal antibody (M02), clone 2F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TGOLN2.
Immunogen
TGOLN2 (NP_006455, 229 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TGOLN2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TGOLN2 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TGOLN2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TGOLN2
Entrez GeneID
10618GeneBank Accession#
NM_006464Protein Accession#
NP_006455Gene Name
TGOLN2
Gene Alias
MGC14722, TGN38, TGN46, TGN48, TGN51, TTGN2
Gene Description
trans-golgi network protein 2
Omim ID
603062Gene Ontology
HyperlinkGene Summary
48
Other Designations
trans-Golgi network protein (46, 48, 51kD isoforms)
-
Interactome
-
Disease
-
Publication Reference
-
Phenylalanine residues at the carboxyl terminus of the herpes simplex virus 1 UL20 membrane protein regulate cytoplasmic virion envelopment and infectious virus production.
Anu-Susan Charles, Vladimir N Chouljenko, Nithya Jambunathan, Ramesh Subramanian, Peter Mottram, Konstantin G Kousoulas.
Journal of Virology 2014 Jul; 88(13):7618.
Application:IF, Monkey, Vero cells.
-
Phenylalanine residues at the carboxyl terminus of the herpes simplex virus 1 UL20 membrane protein regulate cytoplasmic virion envelopment and infectious virus production.
Anu-Susan Charles, Vladimir N Chouljenko, Nithya Jambunathan, Ramesh Subramanian, Peter Mottram, Konstantin G Kousoulas.
Journal of Virology 2014 Jul; 88(13):7618.
Application:IF, Monkey, Vero cells.
-
Distinctive features of degenerating Purkinje cells in spinocerebellar ataxia type 31.
Yoshida K, Asakawa M, Suzuki-Kouyama E, Tabata K, Shintaku M, Ikeda S, Oyanagi K.
Neuropathology 2014 Jun; 34(3):261.
Application:IHC-P, Human, Brain.
-
Abnormal localization of leucine-rich repeat kinase 2 to the endosomal-lysosomal compartment in lewy body disease.
Higashi S, Moore DJ, Yamamoto R, Minegishi M, Sato K, Togo T, Katsuse O, Uchikado H, Furukawa Y, Hino H, Kosaka K, Emson PC, Wada K, Dawson VL, Dawson TM, Arai H, Iseki E.
Journal of Neuropathology and Experimental Neurology 2010 Sep; 68(9):994.
Application:IF, IHC-P, Human, Postmortem brains from patients with neurodegenerative disorders.
-
GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation.
Higashi S, Iseki E, Minegishi M, Togo T, Kabuta T, Wada K.
Journal of Neurochemistry 2010 Oct; 115(2):423.
Application:IF, Human, HeLa cells.
-
CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response.
Barr AR, Kilmartin JV, Gergely F.
The Journal of Cell Biology 2010 Apr; 189(1):23.
-
Phenylalanine residues at the carboxyl terminus of the herpes simplex virus 1 UL20 membrane protein regulate cytoplasmic virion envelopment and infectious virus production.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com