STAMBP purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
STAMBP MaxPab polyclonal antibody. Western Blot analysis of STAMBP expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of STAMBP expression in transfected 293T cell line (H00010617-T01) by STAMBP MaxPab polyclonal antibody.
Lane 1: STAMBP transfected lysate(46.64 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human STAMBP protein.
Immunogen
STAMBP (NP_006454.1, 1 a.a. ~ 424 a.a) full-length human protein.
Sequence
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
STAMBP MaxPab polyclonal antibody. Western Blot analysis of STAMBP expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of STAMBP expression in transfected 293T cell line (H00010617-T01) by STAMBP MaxPab polyclonal antibody.
Lane 1: STAMBP transfected lysate(46.64 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — STAMBP
Entrez GeneID
10617GeneBank Accession#
NM_006463Protein Accession#
NP_006454.1Gene Name
STAMBP
Gene Alias
AMSH, MGC126516, MGC126518
Gene Description
STAM binding protein
Omim ID
606247Gene Ontology
HyperlinkGene Summary
Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq
Other Designations
associated molecule with the SH3 domain of STAM
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com