RBCK1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RBCK1 full-length ORF ( ENSP00000290048, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLPLH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
52.1
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RBCK1
Entrez GeneID
10616GeneBank Accession#
ENST00000290048Protein Accession#
ENSP00000290048Gene Name
RBCK1
Gene Alias
C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP3, XAP4, ZRANB4
Gene Description
RanBP-type and C3HC4-type zinc finger containing 1
Omim ID
610924Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq
Other Designations
HBV associated factor 4|OTTHUMP00000029921|OTTHUMP00000029922|RBCC protein interacting with PKC1|hepatitis B virus X-associated protein 4|ubiquitin conjugating enzyme 7 interacting protein 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com