RBCK1 monoclonal antibody (M01), clone 3C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of C20orf18 expression in transfected 293T cell line by C20orf18 monoclonal antibody (M01), clone 3C3.
Lane 1: C20orf18 transfected lysate(25.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C20orf18 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RBCK1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RBCK1.
Immunogen
RBCK1 (NP_006453, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of C20orf18 expression in transfected 293T cell line by C20orf18 monoclonal antibody (M01), clone 3C3.
Lane 1: C20orf18 transfected lysate(25.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C20orf18 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RBCK1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RBCK1
Entrez GeneID
10616GeneBank Accession#
NM_006462Protein Accession#
NP_006453Gene Name
RBCK1
Gene Alias
C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP3, XAP4, ZRANB4
Gene Description
RanBP-type and C3HC4-type zinc finger containing 1
Omim ID
610924Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq
Other Designations
HBV associated factor 4|OTTHUMP00000029921|OTTHUMP00000029922|RBCC protein interacting with PKC1|hepatitis B virus X-associated protein 4|ubiquitin conjugating enzyme 7 interacting protein 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com