Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBCK1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010616-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human RBCK1 protein.
  • Immunogen:
  • RBCK1 (ENSP00000290048, 1 a.a. ~ 230 a.a) full-length human protein.
  • Sequence:
  • MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLPLH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RBCK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of RBCK1 expression in human stomach.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RBCK1 expression in transfected 293T cell line (H00010616-T02) by RBCK1 MaxPab polyclonal antibody.

    Lane 1: RBCK1 transfected lysate(25.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • RBCK1
  • Gene Alias:
  • C20orf18,HOIL1,RBCK2,RNF54,UBCE7IP3,XAP3,XAP4,ZRANB4
  • Gene Description:
  • RanBP-type and C3HC4-type zinc finger containing 1
  • Gene Summary:
  • The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq
  • Other Designations:
  • HBV associated factor 4,OTTHUMP00000029921,OTTHUMP00000029922,RBCC protein interacting with PKC1,hepatitis B virus X-associated protein 4,ubiquitin conjugating enzyme 7 interacting protein 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook