Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAICS purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010606-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PAICS protein.
  • Immunogen:
  • PAICS (NP_006443.1, 1 a.a. ~ 425 a.a) full-length human protein.
  • Sequence:
  • MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PAICS expression in transfected 293T cell line (H00010606-T01) by PAICS MaxPab polyclonal antibody.

    Lane 1: PAICS transfected lysate(47.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • PAICS
  • Gene Alias:
  • ADE2,ADE2H1,AIRC,DKFZp781N1372,MGC1343,MGC5024,PAIS
  • Gene Description:
  • phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
  • Gene Summary:
  • This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • AIR carboxylase,SAICAR synthetase,multifunctional protein ADE2
  • RSS
  • YouTube
  • Linkedin
  • Facebook