CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CDC42EP3 protein.
Immunogen
CDC42EP3 (NP_006440.2, 1 a.a. ~ 254 a.a) full-length human protein.
Sequence
MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDC42EP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDC42EP3 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of CDC42EP3 expression in transfected 293T cell line (H00010602-T02) by CDC42EP3 MaxPab polyclonal antibody.
Lane 1: CDC42EP3 transfected lysate(27.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CDC42EP3
Entrez GeneID
10602GeneBank Accession#
NM_006449.3Protein Accession#
NP_006440.2Gene Name
CDC42EP3
Gene Alias
BORG2, CEP3, FLJ46903, UB1
Gene Description
CDC42 effector protein (Rho GTPase binding) 3
Omim ID
606133Gene Ontology
HyperlinkGene Summary
CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of, CDC42. This protein can interact with CDC42, as well as with the ras homolog gene family, member Q (ARHQ/TC10). Expression of this protein in fibroblasts has been shown to induce pseudopodia formation. [provided by RefSeq
Other Designations
CRIB-containing BORG2 protein|Cdc42 effector protein 3|MSE55-related protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com