CDC42EP3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CDC42EP3.
Immunogen
CDC42EP3 (NP_006440, 42 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Sequence
IHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAIS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.48 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDC42EP3 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of CDC42EP3 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — CDC42EP3
Entrez GeneID
10602GeneBank Accession#
NM_006449Protein Accession#
NP_006440Gene Name
CDC42EP3
Gene Alias
BORG2, CEP3, FLJ46903, UB1
Gene Description
CDC42 effector protein (Rho GTPase binding) 3
Omim ID
606133Gene Ontology
HyperlinkGene Summary
CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of, CDC42. This protein can interact with CDC42, as well as with the ras homolog gene family, member Q (ARHQ/TC10). Expression of this protein in fibroblasts has been shown to induce pseudopodia formation. [provided by RefSeq
Other Designations
CRIB-containing BORG2 protein|Cdc42 effector protein 3|MSE55-related protein
-
Interactome
-
Publication Reference
-
Protein array analysis of oligomerization-induced changes in alpha-synuclein protein-protein interactions points to an interference with CDC42 effector proteins.
Schnack C, Danzer KM, Hengerer B, Gillardon F.
Neuroscience 2008 Feb; 154(4):1450.
Application:WB, Mouse, Mouse brains.
-
Protein array analysis of oligomerization-induced changes in alpha-synuclein protein-protein interactions points to an interference with CDC42 effector proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com