Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC42EP3 polyclonal antibody (A01)

  • Catalog # : H00010602-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CDC42EP3.
  • Immunogen:
  • CDC42EP3 (NP_006440, 42 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • IHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAIS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010602-A01
    Western Blot detection against Immunogen (33.48 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CDC42EP3 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of CDC42EP3 expression in K-562 ( Cat # L009V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CDC42EP3
  • Gene Alias:
  • BORG2,CEP3,FLJ46903,UB1
  • Gene Description:
  • CDC42 effector protein (Rho GTPase binding) 3
  • Gene Summary:
  • CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of, CDC42. This protein can interact with CDC42, as well as with the ras homolog gene family, member Q (ARHQ/TC10). Expression of this protein in fibroblasts has been shown to induce pseudopodia formation. [provided by RefSeq
  • Other Designations:
  • CRIB-containing BORG2 protein,Cdc42 effector protein 3,MSE55-related protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook