Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRPF8 (Human) Recombinant Protein (P01)

  • Catalog # : H00010594-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRPF8 full-length ORF ( AAH00579.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSPPMPRSWLTTHLGMARRPLSSHAASRQAPVH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 58.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010594-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PRPF8
  • Gene Alias:
  • HPRP8,PRP8,PRPC8,RP13
  • Gene Description:
  • PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae)
  • Gene Summary:
  • Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. This gene is a candidate gene for autosomal dominant retinitis pigmentosa. [provided by RefSeq
  • Other Designations:
  • U5 snRNP-specific protein,U5 snRNP-specific protein (220 kD), ortholog of S. cerevisiae Prp8p,apoptosis-regulated protein 1,apoptosis-regulated protein 2,precursor mRNA processing protein,splicing factor Prp8
  • RSS
  • YouTube
  • Linkedin
  • Facebook