Product Browser

Last updated: 2017/3/26
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMC2L1 polyclonal antibody (A01)

  • Catalog # : H00010592-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SMC2L1.
  • Immunogen:
  • SMC2L1 (NP_006435, 521 a.a. ~ 630 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010592-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SMC2
  • Gene Alias:
  • CAP-E,CAPE,FLJ10093,SMC2L1,hCAP-E
  • Gene Description:
  • structural maintenance of chromosomes 2
  • Other Designations:
  • OTTHUMP00000021818,OTTHUMP00000021819,SMC2 (structural maintenance of chromosomes 2, yeast)-like 1,SMC2 structural maintenance of chromosomes 2-like 1,chromosome-associated protein E,structural maintenance of chromosomes (SMC) family member, chromosome-as
  • RSS
  • YouTube
  • Linkedin
  • Facebook