SCGN monoclonal antibody (M01), clone 2G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SCGN on formalin-fixed paraffin-embedded human yolk sac tumor. [antibody concentration 6 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SCGN is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (56.1 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SCGN.
Immunogen
SCGN (AAH00336.1, 1 a.a. ~ 276 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (83)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (56.1 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SCGN on formalin-fixed paraffin-embedded human yolk sac tumor. [antibody concentration 6 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SCGN is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — SCGN
Entrez GeneID
10590GeneBank Accession#
BC000336Protein Accession#
AAH00336.1Gene Name
SCGN
Gene Alias
CALBL, DJ501N12.8, SECRET, SEGN, setagin
Gene Description
secretagogin, EF-hand calcium binding protein
Omim ID
609202Gene Ontology
HyperlinkGene Summary
The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. [provided by RefSeq
Other Designations
OTTHUMP00000016124|calbindin-like|secretagogin
-
Interactome
-
Publication Reference
-
Distribution patterns of calcium-binding proteins in pancreatic tissue of non-diabetic as well as type 2 diabetic rats and in rat insulinoma beta-cells (INS-1).
Bazwinsky-Wutschke I, Wolgast S, Muhlbauer E, Peschke E.
Histochemistry and Cell Biology 2010 Aug; 134(2):115.
Application：IF, IHC-P, Rat, INS-1 cells, Rat pancreata.
-
Proteomic analysis of normal human nasal mucosa: Establishment of a two-dimensional electrophoresis reference map.
Lee JY, Byun JY, Lee SH.
Clinical Biochemistry 2009 May; 42(7-8):692.
Application：IHC, Human, Nasal mucosa tissue.
-
Distribution patterns of calcium-binding proteins in pancreatic tissue of non-diabetic as well as type 2 diabetic rats and in rat insulinoma beta-cells (INS-1).
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com